SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015640 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015640
Domain Number 1 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 357-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 168-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000379
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015640   Gene: ENSDORG00000016625   Transcript: ENSDORT00000016625
Sequence length 419
Comment pep:novel scaffold:dipOrd1:scaffold_34050:4748:14271:-1 gene:ENSDORG00000016625 transcript:ENSDORT00000016625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSAPAHCQESVTFEDVCVIFTDEEEYLVPVQNALYNVVMLENYQNIVSLGLPVLQPD
VIFQLKKGDMSWKEGLHGSEEKECPESLALVWKTKPDLQDASEEGKLRESLERQSPLCPK
IEVQAPESGLKTKKKSLSVEPCKKSYSQDKSLKRGSPKKVLTKDRDQECSDCGKTFFDHS
SLIRHQRTHTGEKPYNCPECRKAFSHRSSLSRHLMSHTGESPYECSVCGKAFFDRSSLTV
HQRIHTGEKPFKCSECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKSILTRHQLI
HTGRKPYECNECGRAFYGVSSLNRHQKAHAGEPRYQCNECGKAFFERSSLTQHQKIHTGD
KPYECSQCGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRRYAKQGID
Download sequence
Identical sequences ENSDORP00000015640 ENSDORP00000015640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]