SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015716 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015716
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-81
Family Protein kinases, catalytic subunit 0.000000000886
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015716   Gene: ENSDORG00000016706   Transcript: ENSDORT00000016706
Sequence length 537
Comment pep:novel scaffold:dipOrd1:scaffold_372:31094:84502:-1 gene:ENSDORG00000016706 transcript:ENSDORT00000016706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQPYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPXXXXXXVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences ENSDORP00000015716 ENSDORP00000015716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]