SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015746 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015746
Domain Number 1 Region: 536-671
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-46
Family Oxysterol-binding protein 0.0044
Further Details:      
 
Domain Number 2 Region: 723-777,818-931
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.96e-43
Family Oxysterol-binding protein 0.0063
Further Details:      
 
Domain Number 3 Region: 94-134,168-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000174
Family Ankyrin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 237-345
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000587
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015746   Gene: ENSDORG00000016742   Transcript: ENSDORT00000016742
Sequence length 939
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5093:116277:264979:-1 gene:ENSDORG00000016742 transcript:ENSDORT00000016742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTETEQQLLHHARNGNVEEVRQLLETMEKNEVIAVINCKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELVMLLLEYNADTTVVNGNGQTAKEA
SHDKEIRNMLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCAIKLLKSGADPNLRNKNDQKPLDLAQGAEMKHVLVGNKVIYKALKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQSDAIHNVYRQGCKHLTQAVCTVKSSDSCLFF
IKCFDDTIHGFRVPKNALHQSRENWLEAIEEHSAYSTHYCSQDQLTDDEEDDAVSAIDLK
QSIQKAQTCQQRLDREISSFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALSDCLN
IFTKQEGRNLKLEQEQEKILSALETLATEHHELESLVGSPPPSILSEDEFYDALSDSESE
RSLSRLEAVTAHSFEEEEEHLNSGKHRMSEGKDCGGGDALSNGIKKHRTSLPSPMFSRND
FSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMHCV
AAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLFGVSHHLPISAFHAELNNDFIF
HGIYKLKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFEAYK
KNDKRNTEEKKNSKQMSNSEESDEMPMPDSESVFVIPGSVLLWRIAPRPPNSAQMYNFTN
FAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSE
EDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences ENSDORP00000015746 ENSDORP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]