SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000003239 from Tarsius syrichta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000003239
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.16e-75
Family Proteasome subunits 0.000000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000003239   Gene: ENSTSYG00000003533   Transcript: ENSTSYT00000003534
Sequence length 255
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_1337:8196:36359:1 gene:ENSTSYG00000003533 transcript:ENSTSYT00000003534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Download sequence
Identical sequences A0A1U7TMB4 H0WGA7
ENSTSYP00000003239 ENSTSYP00000003239 ENSOGAP00000000339 XP_003794460.1.62490 XP_008054876.1.4292 ENSOGAP00000000339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]