SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000005399 from Tarsius syrichta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000005399
Domain Number 1 Region: 845-980
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-33
Family DBL homology domain (DH-domain) 0.000000217
Further Details:      
 
Domain Number 2 Region: 350-428
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.28e-26
Family Regulator of G-protein signaling, RGS 0.00000865
Further Details:      
 
Domain Number 3 Region: 28-122
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-21
Family PDZ domain 0.026
Further Details:      
 
Domain Number 4 Region: 1078-1118
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000182
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000005399   Gene: ENSTSYG00000005867   Transcript: ENSTSYT00000005901
Sequence length 1561
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_3449:1286:64559:-1 gene:ENSTSYG00000005867 transcript:ENSTSYT00000005901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDISETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVSVSGLXXXXXXXXXXXXXXXXXXXXXXXXXXXPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGTRRRVTQLQLKIQQETGGSVDIPPLY
GDTGQRPPEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMT
RVAQHHRRQGSDAPVPPTSDQGADQSSKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVHQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSKYEEDRSAPMDFALNTYMNHAGIRLREIRPSNTAEKAQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKGENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKFR
EEGPIIKEISDMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAE
SHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVN
EAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKR
AFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEVVRNATRHPGTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVAGSKVVPALPESG
QSEPEPPEVEGGTKATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSHTPLEDSTADVTTSPG
P
Download sequence
Identical sequences ENSTSYP00000005399 ENSTSYP00000005399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]