SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315500922|ref|YP_004079809.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315500922|ref|YP_004079809.1|
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000955
Family SMI1/KNR4-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315500922|ref|YP_004079809.1|
Sequence length 181
Comment hypothetical protein ML5_0104 [Micromonospora sp. L5]
Sequence
MTPNASPTVDRLAGLFDWDGATETEIDWTALTEAAGHPFPEDYRRFVERFPHGSIGFLEV
LHPSDWGVPEFLRYARNWHHVMNKRAECTGGFPYHFGTSPGDLRVWGAVNFDYLLCWHLD
DGPPEQWPTVVCDTALIDPPEPYAGTATALLVEIAELRNPVPVIGYVTEIDGVPFRLVRH
E
Download sequence
Identical sequences WP_013473378.1.11406 WP_013473378.1.62906 WP_013473378.1.64435 gi|315500922|ref|YP_004079809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]