SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315501458|ref|YP_004080345.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|315501458|ref|YP_004080345.1|
Domain Number - Region: 15-47
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00249
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315501458|ref|YP_004080345.1|
Sequence length 192
Comment hypothetical protein ML5_0644 [Micromonospora sp. L5]
Sequence
MGVEAAQRLAALGCCEIEDGLTDAEFARIEREFGFEFAEDHRAFLAVGLPVSSAPEDGAT
WSNPWPDWRGGDPEALRMHVNWELDFLIERVEDGEWDPRWGSRPSTRDMASREARRVLLA
APKMVPVYGHRFLPAGRGSYGHPVLSMWGWDIIVYGADLLDYIGNEFDRTYDDRQQAEVT
VPFWRDYLPTQA
Download sequence
Identical sequences WP_013473701.1.11406 gi|315501458|ref|YP_004080345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]