SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315505161|ref|YP_004084048.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315505161|ref|YP_004084048.1|
Domain Number 1 Region: 1-56,94-425
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.4e-78
Family Gtf glycosyltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315505161|ref|YP_004084048.1|
Sequence length 428
Comment hypothetical protein ML5_4420 [Micromonospora sp. L5]
Sequence
MRVLLTTFAVRSHIYSLVPIAWALRAAGHDVCVATHPEGEEHVVSAGLPFAGVGEPIPSV
GEQDTGGDVESGAAQDGGGTFGWADWPELLDLAETDPTTLTYDYLLGVFAAYTPMVFRYY
TDGMVDGLVEFARRWKPDLVLWDTMSFAGPVAAAACGAAHARVLFGLDILGHARGAFLRA
AARRPASACDDPLREWLDGVLRRHGSTFSEDVVIGQWTVDPVVSSLSLGTASPRIGMRYV
PYNGPSVVPAWLAELDPEVPRVCVTMGISHREIWGADRVPVARLLDGIADLGVEVVATLS
GGQRDGVDTERVRVVDFAPLDALLPLCSAVVSHGGAGSFQTALVHGVPQVLVPDMLWDTG
LKASRLEQLGAGLRVREVPATSALVERALTDRRLRDRATRLRREALGMPAPREVVPVLER
LTARHGVR
Download sequence
Identical sequences gi|315505161|ref|YP_004084048.1| WP_013476221.1.11406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]