SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315505420|ref|YP_004084307.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315505420|ref|YP_004084307.1|
Domain Number 1 Region: 1-383
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.61e-72
Family Gtf glycosyltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315505420|ref|YP_004084307.1|
Sequence length 387
Comment hypothetical protein ML5_4680 [Micromonospora sp. L5]
Sequence
MSTWGWRSHFYSLVPLGWALQAAGHEVRVASHPSLAATISAAGLAAVPLGADVDFAEAFA
GRIGTVAPLAGSAPAGAVVPAITADGGVVRFADAVLDDLVSFGRSWRPDLVLWEPFNLAA
PVAAAALGVPGVLNLWGPDSSTTLRLDPDQVVGPLAARFGLRAADVPLDGVLTLDPVPPP
MQVPTARPGRPVRFVPYNGPAVVPDWLRRPAGRPRVCVTAGTMMAAAGLHDRFDLGGVIR
AVAGLDVEVVVVVEPRQHEGLGPLPARVRLVDGPLAVRLVLPTCAALVQQGGAGTTMTAL
AYGVPQLVLPQVSDQHFNAERLAATGAGTSLTGEQATADAVRELVGELVGDGPRRRAATS
MRDRVHAMPAPADLVPALAALARGGPI
Download sequence
Identical sequences WP_013476412.1.11406 gi|315505420|ref|YP_004084307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]