SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315506847|ref|YP_004085734.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315506847|ref|YP_004085734.1|
Domain Number 1 Region: 13-171
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000471
Family Gtf glycosyltransferase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315506847|ref|YP_004085734.1|
Sequence length 193
Comment glycosyltransferase 28 domain-containing protein [Micromonospora sp. L5]
Sequence
MAHIPQQRDRRSAAPYVLVVVGTDVHRFDRLVGWLERWHAARPEVRLVLQYGHSRTPALP
EATPFLGHEELQRAMAEATLVVSHGGPATITEARRNGHLPIVVPRDPSHDEHVDNHQQLF
SRRLGAAGMVRLCESEAELLAALDEGLADPNRFVLAADPNRPDPRAEAVARVGAVIDELV
ARRVRQRAVGRRG
Download sequence
Identical sequences A0A1S1WJX7 D9T2X3
gi|315506847|ref|YP_004085734.1| gi|302870610|ref|YP_003839247.1| WP_013289268.1.11406 WP_013289268.1.62906 WP_013289268.1.64435 WP_013289268.1.81987 WP_013289268.1.89352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]