SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315506744|ref|YP_004085631.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315506744|ref|YP_004085631.1|
Domain Number 1 Region: 25-169
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000288
Family SMI1/KNR4-like 0.012
Further Details:      
 
Domain Number 2 Region: 202-308
Classification Level Classification E-value
Superfamily ARM repeat 0.000000179
Family GUN4-associated domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315506744|ref|YP_004085631.1|
Sequence length 319
Comment hypothetical protein ML5_6036 [Micromonospora sp. L5]
Sequence
MREEALMDDRIARIQAKLAALPSAEKPVLNPALTEQQVSSFEDLHGIRLPEEFRQFVTRI
GHGGYGPTYGLLPMDRWVPPRMGVHGNLAEPFSLVPDSYVSAWSGGGGEPTLPFPGTIAV
VWGGCTQYTLLVVTGSGRGRLVEVIAGSDVVPHFHTDADFLAWYERWLDFTLAGHRDLTW
FSHQMAGDEPELVDTLINGSIATRRNAAAYTFITYPQPSPSLLDVLAQALSAEPHPIVRE
TILRALQAQGEQGRDLLPAALTDPVPDVRRLAASLMTTNTRQGIRLSPKLRRTLADHLRV
EDDRSVRDTIQRLLDLSHR
Download sequence
Identical sequences gi|315506744|ref|YP_004085631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]