SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310639740|ref|YP_003944498.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310639740|ref|YP_003944498.1|
Domain Number 1 Region: 559-759,789-925
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.72e-36
Family beta-glycanases 0.007
Further Details:      
 
Domain Number 2 Region: 5-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.62e-18
Family Leech intramolecular trans-sialidase, N-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 432-539
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000425
Family CBM4/9 0.017
Further Details:      
 
Domain Number 4 Region: 1152-1242
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000432
Family alpha-Amylases, C-terminal beta-sheet domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310639740|ref|YP_003944498.1|
Sequence length 1246
Comment alpha-L-arabinofuranosidase [Paenibacillus polymyxa SC2]
Sequence
MTKFQDQIIARYKFDDAENVGKDSSGQGNDGIASGTAAPTISHTTGRAALALEGGPNGTS
YIQLPSDLFKDVSDNTGVTVTAWVNFGRFTDMWERVFDFGKSHTGPYMFMTRNLRGTLFT
EADLSVDPGRGFVRDEWMHIALSVIGTEGGTLSSAGPVVYVNGEVAADGSISQTSSGNYA
KLRKWFETFADSTNYSNNFIGRSQHAADVDFAGLVSDFRIYKAGLTADEVIEVMCDSLTD
EEIVKLARDKYLSFPTTIITKDISLPTVLMGGRVEVTWKSSQPSILSDNGRVQAITSAQG
VTVTALLTRGSSRIEESFEVSVLPEQLPPYTLTIHGNKEVVDVSEVMYGLFYEDINNAAD
GGIYAELVQNRSFESFEFDTYSHASGECGCSTGRNRNPLFAWSGDTDKMNPQHSGGLNEF
LGAKDKDVNSYYVTVADGATIRNKGFSDSNQNCAMSIQEGAKYEFTIWAKADSTGTITLQ
LQDSKEKDISDSVTVQVEGGSTWKKYGVDSKLVLTGTATVLGQLALTFEGDISIDMVSLF
PQDVWGAGEEEQSPSAHANYQGNPNYRLRKDLVNALVGMHPKFLRFPGGCISEGSFIWEN
VYDWKESIGDIELRKENFNVWGYMMTMGLGYMEYFQLAEDLNAAPLPVMACGVLCQARSD
YAHPAGGALREYYIKNFTDLIDFAISVDFEHNEWAAMRKKMGHEAPFDLRYLGVGNENWG
TEFFANFEVFKTSIDEYMEKNYPGYELHIISTVGAQADDDAYQQGWKFLSGNMKGSAKVA
FADGNQVTEETVTWYEKQKDYMDTIADEHYYRSNEYLLNNVDRYNYYYRAYNADGSVNWK
ETSKVFVGEYASTDKNTLAGAVAEAAVMTGFENNADVVRLAAYAPLFNKVLTDGTYRWTP
DCIWFDDETVWFTPNYYVQQMYAQYLGDKVLATSFSTYKNGKPIDLIPQGGIEIATGNAE
VVVKRVTVTSNKDGSVLLDQDFTKELNSLWKVIPGSVGSTLEEGKGLVLKAQDSGLNGLY
ILNDSWNNYKVEVVASRLSGTDGFYVGIGLTDITTEKKNVIEYAIGYGGNATGVKVYKQG
IEGYTMGDYSSSTAAGNLRAASYEELADNTDYTITVNYGGETGNNLICSYTDGKTTSKVL
DYKLEAYNRDVFNSVTQDAEHVYVKLVNADNVDKATQLNLEDMSVESIAKLITLTGDSSL
VHVPNVNKKNDEKIVPTEQQVTLHTNSVLLQLPANSVNVLVLDLKA
Download sequence
Identical sequences E3ECB4
gi|310639740|ref|YP_003944498.1| gi|386038941|ref|YP_005957895.1| WP_013368899.1.14980 WP_013368899.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]