SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310639754|ref|YP_003944512.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310639754|ref|YP_003944512.1|
Domain Number 1 Region: 327-616
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.68e-86
Family beta-glycanases 0.000000497
Further Details:      
 
Domain Number 2 Region: 725-1011
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-80
Family beta-Galactosidase, domain 5 0.00026
Further Details:      
 
Domain Number 3 Region: 9-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-60
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000432
Further Details:      
 
Domain Number 4 Region: 622-712
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 4.03e-22
Family beta-Galactosidase/glucuronidase domain 0.003
Further Details:      
 
Domain Number 5 Region: 223-325
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 8.06e-20
Family beta-Galactosidase/glucuronidase domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310639754|ref|YP_003944512.1|
Sequence length 1014
Comment family 2 glycoside hydrolase [Paenibacillus polymyxa SC2]
Sequence
MTIHTPSLDWLTDVTKFAVNRLPAYSDHKYYATLQEAEHQADMAWRHSLNGSWKFNYATN
PATRPVEFYAPDFEYGGWSDIQVPGHIQTQGFGQMQYANTMYPWDGHSDVRPPHIPEDHN
PVGSYIKRFVLPENMASDAQPVFISFQGVESAFYVWLNGQFVGYSEDSFTPSDFELTPYL
QAGENKLAVEVYQRSTGAWLEDQDFWRFSGIFRDVYLYTIPTVHVRDLHAKADLDATYTQ
GLLELKLTLEQPATAHTTVDVKDAAGHIVACLKADFTDGIASLSATLEQVERWSAEKPYL
YTLFIQIYDADGSLVEVIPQKVGFRKFEMVNKVMHLNGKRIVFKGVNRHEFNARTGRAIS
REDMLWDIRTLKQNNMNAVRTSHYPNQTLWYELCDEYGIYVIDEMNLETHGSWQKLGAVE
PSWNIPANLPEWQDIVMDRAISMLERDKNHASILIWSCGNESYAGEVLRNVANYFRSTDP
SRLVHYEGVFHNRTYDDTSDMESRMYAKPADIEQYLNDNPQKPYISCEYMHAMGNSVGGM
HKYTELENKYELYQGGFIWDYIDQAVMKKDRYGREYLAIGGDFDDRPTDYGFCTDGIVYA
DRKVSPKMQEVKFLYQNLKLIPDTQGVTIRNENLFEGTGDYELVYSLLHEGQEIARNVSH
VDVAAQTEAYIPLTFPSTDEKPGEYVIHTALVLKEATLWAKAGHEVAFGQHIFIVEDPNP
LKAPIAGALRVVHGDVNIGVHGTDFTIMFSKGAGSLTSLRYAGREMIATPPAPLFWRATT
DNDRGTALGFEAGGWFAASLTRKCVDIEVTEEQTDRVTITFRYTLSIHADVQVTVTYTVL
ADGSLNVKSTYEGVSGLPTLPIFALSFKVPADYRHLDWYAMGPEENYIDRALGARLGVFR
NEAADNVSGYVVPQESGNRTGVRRVDITDDSQRGIRITAPATAPVECNISPYTAFELESA
GHLYELPNVYYTVVTVAGKQMGVGGDDSWGAPVHEEYQIPADQKLEFEFTVQRI
Download sequence
Identical sequences E3ECC8
gi|310639754|ref|YP_003944512.1| WP_013368913.1.14980 WP_013368913.1.91857 gi|386038955|ref|YP_005957909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]