SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310639938|ref|YP_003944696.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310639938|ref|YP_003944696.1|
Domain Number 1 Region: 501-668
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-49
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 712-864
Classification Level Classification E-value
Superfamily CheY-like 1.28e-38
Family CheY-related 0.0023
Further Details:      
 
Domain Number 3 Region: 430-513
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.16e-17
Family Homodimeric domain of signal transducing histidine kinase 0.00089
Further Details:      
 
Domain Number 4 Region: 900-1037
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.56e-17
Family Histidine kinase 0.012
Further Details:      
 
Domain Number 5 Region: 32-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000141
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310639938|ref|YP_003944696.1|
Sequence length 1046
Comment sensor protein [Paenibacillus polymyxa SC2]
Sequence
MKKQGVLFFIILLLAVALPVYPLVSGVLSGNSHWKAHNGVIDLRNWDPDKEGAVQLGGEW
EFYPNQLFQPSSFQETRYQDWGNRQNSSKLGLGTGSSAKIVDVPGKWNQWMPGGQATGYG
TYHVRVLLPEKVENLYGIHMQNIRNSSRVWINGAEVGASGIPSVSADKGKQGNAPFVGFA
AVDGHSADITVHVANYSYSSGGIIYPLLFGDYASITHSREVAMAEDTVLVAGFFIPTVFF
IMLYFLRRKEKALLYLACFCIAALFYILTHGEKLLVWGMPDLPYEWILKIQSFSSTLFYY
FLIRYVHLTTQIVMNRIVLLLYNIVTALMLGMGLLLPTLVLSSFETFILLFGVVSVGYVL
LILIRGLLQRTDDAALLVISIMSILMIVVTSFVYVLGWGDVRGVTAYEMLIFVLAQTLLL
AKRFVHSFMEVENLSRRLLTLDGLKDEFLANTSHELRTPLHGIINIAQSMLDRYGAQFNE
PQKHNLALIVNVGRRLSYLINDILDFSNLKNGRLALNRRPVNVQTAVNSVLEVLGHNVGK
KKLQFVKEWPNSLPKVDADEDRLNQILYNLLGNAMKFTEEGEIVISAKVRNREMEISVKD
TGPGIAPDHLSHIFEPFNRGANAEDKGYSGTGLGLGITRRLVELHGGYIRVESRLGKGST
FYFTLPLAETGTSAHEVQKDVLSEVILKPGVTSNQGVNPLEEDGLEQVRNVPYRVLAVDD
DGVNLRVLEELLYATGCSVVAVDHAEEALQLLNGRARFDLVITDWMMPEMSGIELCRRIR
EGYSLSELPVLLLTARDLPGDIHAGFMAGANDFLRKPVDAEELKARVRTLLNMRNSAEEA
VRSEMAFLQAQIKPHFLYNALNVIVSTVAVDPDKAAELLMELSQYLRGSFDFQNRENTVP
LCKELELVESYVALEKARFEERLQVTIEVGRNIRSLIPPLSIQPIVENAIRHGVMQRATG
GTVRVIVQEDGADFVVSVTDDGVGIPPERLQQLLSEEHVSSSVGLRNIHRRLIHMYGEGL
RIESNPMQGTTVSFRVPETILSHPTE
Download sequence
Identical sequences E3ED98
WP_013369095.1.14980 WP_013369095.1.31500 gi|310639938|ref|YP_003944696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]