SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640064|ref|YP_003944822.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640064|ref|YP_003944822.1|
Domain Number 1 Region: 338-620
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-61
Family beta-glycanases 0.00023
Further Details:      
 
Domain Number 2 Region: 207-325
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000149
Family Family 6 carbohydrate binding module, CBM6 0.052
Further Details:      
 
Weak hits

Sequence:  gi|310640064|ref|YP_003944822.1|
Domain Number - Region: 91-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000595
Family Proprotein convertase P-domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310640064|ref|YP_003944822.1|
Sequence length 656
Comment beta-mannanase [Paenibacillus polymyxa SC2]
Sequence
MPDPWKRRSFGILSFVLLSFLLVSLNLIPSLAKAESAPLVTGVEDRTVMNASQDLSTNGN
SSPIVVSSKDAILQGYGVEKRDTPYTGDTLYKGDGYVSFFYDYDPNSGKSDGTATFKVNV
PTAGLYRLSLGYYIPADTGSKDTSIKVNGTMAENITLATPPKGAAVNEKMVTKIMLNAGT
NELTFSRGWGYYGIEYVKVEFANLPAAISKMEAEDGAITGKVSIEAADTGYSGTGYATFK
GTGSLTFAYNAASSGLYNLAIGYSNPNGDKKTQLVVNGQTSETSLPTTASYTEVSGGKLM
LSAGNNTIQFNVDSDQYHIDYVKLSAVSPPKLYQIEKKPVNPNATAETKALMGYLVDSYG
SNILSGQHTLEDAQWIKDQTGKYPAILSTDMMDYSPSRIEHGATSTEVEKAIQWAKEGGI
VTFAWHWNAPKGLHDIPGKEWWRGFYTDATTFDVQYALTHPESEEYQLILRDIDAIAAQL
KRLQDAHVPVLWRPLHEAEGKWFWWGAQGPDSAKQLYHIMYDRLTNYHHLNNLIWVWNSE
SPEWYPGDDVVDIVSVDIYNQAANYSPSIGKYDSLVNLVQGKKLVGLSENGPIGDPELLQ
TYSAHWLFFTTWTGDFIRNGQYNSLDHLIKVFNSDYVITRDELPQDLFTSSKNEAE
Download sequence
Identical sequences E3EF61
WP_013369220.1.14980 WP_013369220.1.91857 gi|386039247|ref|YP_005958201.1| gi|310640064|ref|YP_003944822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]