SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640129|ref|YP_003944887.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640129|ref|YP_003944887.1|
Domain Number 1 Region: 278-564
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.5e-66
Family beta-glycanases 0.00075
Further Details:      
 
Domain Number 2 Region: 4-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.31e-41
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0068
Further Details:      
 
Domain Number 3 Region: 166-273
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 8.06e-17
Family beta-Galactosidase/glucuronidase domain 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|310640129|ref|YP_003944887.1|
Domain Number - Region: 675-717
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00034
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310640129|ref|YP_003944887.1|
Sequence length 780
Comment family 2 glycoside hydrolase [Paenibacillus polymyxa SC2]
Sequence
MGSRVIMPFRTDWTFVEGNYTGAEKTDYNDGHWRDLHLPHDWSIEKSFDPHMPYGGNQAY
LPRWSVGWYRKHFNVEPSSPKQRVYIQFDGIHSNSEVWLNGHFVGKRPYGYVSFQYDLTP
YIRWDEENVIAVKVGNTLLPPDRWYSGAGIYRNVWLIYTDYLHITEWGTYITTPEISPDE
AKVSARIQVSNHYAHAVECTIMTEILDSQGQLKGKIENRVTLAGLESEEIEQKTRVLEPE
LWSPDHPVLYEAQTTIYCDNTEVDRYRTPFGIRKVILDSQKGLLLNGSSLKLKGVCIHHD
LGCLGAAYHDTAMKRRLEKLKEMGCNSIRFAHNPMAPELLDLCDQMGFLVVDEAFDKWKS
LSYEHLYDEWWEKDLETMLVRDRNHPSVLMWSVGNEVENQGQPSMLNMLEKLVAFCHKKD
PTRPVTCALEPHNTPISLRDGSIESKVEHTKLLAQRVDVLGLNYQEQWYEHYRAAMPDTL
ILGTETFPYYRGKDNRVKGYLPLNPWFDVANHDYVIGQFVWSGIDYLGETSYPSKGWSSG
LIDTCGFRKPVSYLQQSLWSDQPVVHIAVFNDHMKSEYNPTWTMHWKSPTMEDHWTFPEY
AGKLIGLVTFTNCESVELIVNEESYGERKLTDFPNHLILWELPYTPGKIRAIGRNGNQQV
CEHELTTAGLPYALKLEANRAILPADGHEISHVEVTVIDQHGIVVPNQDVDLSFELHGDG
RILGIDNGDLTSDEPYKGKERRTHRGRCLVIVQSGDVAGELLLQASADGELQGEVSLKVE
Download sequence
Identical sequences E3EGK7
gi|310640129|ref|YP_003944887.1| WP_013369283.1.14980 WP_013369283.1.91857 gi|386039306|ref|YP_005958260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]