SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640151|ref|YP_003944909.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640151|ref|YP_003944909.1|
Domain Number 1 Region: 40-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.9e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.036
Further Details:      
 
Domain Number 2 Region: 184-260
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000292
Family Fibronectin type III 0.008
Further Details:      
 
Weak hits

Sequence:  gi|310640151|ref|YP_003944909.1|
Domain Number - Region: 731-788
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00341
Family Cna protein B-type domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310640151|ref|YP_003944909.1|
Sequence length 1296
Comment peptidase m28 [Paenibacillus polymyxa SC2]
Sequence
MLEGNSFTRNKLKPYRVLVPLMPLISGAFLFIGTNEAHAAGWENVVFNKPTTSSGYTQPY
DPSRAVDGSVDPTSRWYQASNGEKWIQVDLRDWYIVDRYVVTGMGVHYGWNDQRDPYSFR
LQTSSNGFNWATVDTVQNNGSSNFQKSIPPVTARYLRLYIDQGNARNNQWASIMEFAAYG
ERLPVPQAPGHFTGIKNGNTVELSWDAVPYATSYKVVRDGITLYTGSLTQFIDTSALPPG
EAVYTVQAVNAKGESTPSEVKVNILTDAERVAQAKAALALSLAPGDTVESVSQKLTLPLT
GLNDTTVSWSSDTPDVITNEGAVIRPRYDLGDQKVKLTATIAKGTASDTQTFEVTVSKMT
AQDTLNQAADILSLGDLSAVQENVSLPLSGYGGVQIEWSSSKPLVIAADGTLTRPSYSSG
DTDVTLTATLQLAGLTKTKDFTAHVLRLPMSDTEAVNAAYRALELPLTTVTGDVYLAKDA
LNGVQVSWSSSQPQFLDHTGHVTFPTYVQGDQTITLEAIVSRGGIELRKTFSLLVPALPV
SADEAVNLAAKTLNLDYPEGIKDSITLPRTGAFDTQIDWSSDRPNILSDSGQVNRPKYTD
GDMNVQLIAMISKGIASVQKTFTITVLKALPNTPYVRLNGSNPIVLETGDSFTDPGASVL
DSVYGNILIPDLSGIGNVDTNVPGVYVLNYTYSDNGSWTAEPAERRINVLPRAVAAAAGD
EDIASVIVTGALPNARLELYNAQQELIAEGIASSEGKYTFTPVPEGASYYVLQNVNGMKS
APSGLVSPQGLTAQRVADSITSIPAPTTSDTMLILPAVPDGFRVTISSSSQPDIVRTDGT
IFQRDTPSVVTIILDVMKASDGSHALTQAIKVIVPAKVTVDTGKSNKDKNEDQDLSAGVQ
QIVFSEQGKAVSLFVPSPAFLDEQIQQALREGKAYADIRLEQEKQMSRVLLTHSVLNKWA
QIGASVISRYGTLMLSSDTLTSMAASGQQDVTISFQQADQQFRDWAEQQSNLKLIGAAVE
IKANVTGTSSIVLPLDSESSSELQNVEPQFSILVMYENGEREILKGTAVINSQGILSGVS
LNTPRLGTFAVAVSTDASQVDQTDVQNDPIHSSDSQEPAQVWPDLQDHWAAKSLQSLAAK
GWMQGYKDGNMRPERAVSRAEFVAILIRALGTTGDESLSTSFTDMKGHWAGSAVDAAHRQ
GWIQGLTAQTFGPDESLTREQAMVILSHAMQKQTSVSSPTGLQSYKDDQQIASWASTAFE
KAIGSGWISGYPDGTLKPKAAISRGEMAELLVRIFK
Download sequence
Identical sequences E3EGM9
gi|310640151|ref|YP_003944909.1| gi|386039326|ref|YP_005958280.1| WP_013369305.1.14980 WP_013369305.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]