SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640519|ref|YP_003945277.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640519|ref|YP_003945277.1|
Domain Number 1 Region: 339-663
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.66e-83
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 662-826
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-33
Family Glycosyl hydrolases family 32 C-terminal domain 0.00042
Further Details:      
 
Weak hits

Sequence:  gi|310640519|ref|YP_003945277.1|
Domain Number - Region: 839-917
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00251
Family Invasin/intimin cell-adhesion fragments 0.0086
Further Details:      
 
Domain Number - Region: 947-1073
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00327
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number - Region: 230-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0752
Family Galectin (animal S-lectin) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310640519|ref|YP_003945277.1|
Sequence length 1085
Comment glycosyl hydrolase domain-containing protein [Paenibacillus polymyxa SC2]
Sequence
MRIKLTNTRMNLTDWQIKGQGHIEDNVQGLLLRSEPQENVMAMSATMSEDFTFEADVMVT
DLQADAALVFRSSRDGWFSYMLQIVPSAGLVRLRDAAGDIERLKEERPIELQKGDIYHLK
VKVEGPHLKVYWDEGYHPIIDVVDTTYTSGYLGLNVWNGAALFQNIQVSDMDTNVGEMLL
IRGKWQPDLKGQRAEETSMEGALKIYDTAAADLVMEGSVTLNSSQPGMEAGLFFRGNQKG
TEGYVASVQGEDHQVRVHLKKANGTLVASSAMPYLDTSGSKHSLEIIAHGERIRVFVDGY
TPAAIDIVDNSYSSGFIGIKATGGTAYFQDLYLTPVSNYYTEKYRPQYHYSPARGSASDP
NGLVYFEGEYHLFHQDGGQWAHAVSLDLLDWKRLPLALKWNDLGHIWSGSAVADLTNTSG
LFSDYGGKGLVAYYTSYNPDQPKGNQRIGLAYSTDRGRTWQYSEDRSIVIENPGQSENDP
GNWDFRDPKVVWDEAHQRWIMVVSGGDHIRFFTSANLLDWSWTDNFGYGDYIRGGVWECP
DLFPLPVDKGNTSKWVLMISTGASTNTQGSDAEYFIGELTSDGKFQNDLPPGKVLKTDWG
KEFYASMSFTNIPGGRRIMLAWMTNWDYPFSFPTSSWKGQFSIARELSLKTTREGIRLIQ
HPISELTSLRSHLFSLDHESITESSPNILEGLNAGAYEIEAEFEFPSVGMASTFGFYVRE
GGEQRTAVGYKTDVQQMFVNRADSGFADFSPLFSTFHEASLAPVGNRIQMRIFVDESSVE
VFGNHGEVVFSDLIFPDSARRGMSFYTQGGEVKVVSLRVYALRNSWRVTEASPIRLMMDY
TQLELAEGQSKRLYASVEDHSGRKGHLLNWESSNPAVVKVIVSNEGFATVEALFPGEAVV
TASIPGDTVRASTSVTVHGGMFYTNLSGWKPDVSASRWMVTADGMRGSYISDANYMASEQ
AKDFTYEADMKLDGNGSAGSMIFRANADGSSGYYLNLDPNMKSIRLFYKKEGRFEEQQVL
TKVPRFVLPGVTYHIKIQAKGLRLRIEIDDEQVIDLEDGTFAAGHFGINVFGGQAFYQNV
RVEKV
Download sequence
Identical sequences E3EEB3
WP_013369669.1.14980 WP_013369669.1.91857 gi|386039660|ref|YP_005958614.1| gi|310640519|ref|YP_003945277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]