SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640548|ref|YP_003945306.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640548|ref|YP_003945306.1|
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.34e-43
Family TAP-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310640548|ref|YP_003945306.1|
Sequence length 224
Comment lipolytic protein g-d-s-l family [Paenibacillus polymyxa SC2]
Sequence
MSSTGHTRILFQGDSITDGGRGRNEDANHWLGQSYVYLIAGALGSRLADTQPEFVNRGVS
GDRVSDLYARWNEDTFSLQPNLLSILIGVNDAWRIVEQEPSGVTDRFERAYCHLLEETRE
VMPDTGLVLCEPFILKTGATEARWDIWQEKITGYQRIVRQLADKYGAVFVPLQSMLNEAA
TKADASYWLHDGVHPTAVGHQLIADQWIDIVQKSPLAIRQPSRT
Download sequence
Identical sequences A0A0S2KQT2 E3EFA2
WP_013369698.1.14980 WP_013369698.1.91857 gi|386039688|ref|YP_005958642.1| gi|310640548|ref|YP_003945306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]