SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640636|ref|YP_003945394.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|310640636|ref|YP_003945394.1|
Domain Number - Region: 310-372
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0705
Family CBM4/9 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310640636|ref|YP_003945394.1|
Sequence length 851
Comment hypothetical protein [Paenibacillus polymyxa SC2]
Sequence
MASEKTPNLGLNQIDRTSPKTTYFDLEKYLDQNWRSVDEFAGEVNDGVNEIKKRLDTTER
KAVTLEPGVQIVHAEKAAPFSLTGLSGRTLVNLLGRWGNLSSLMGVTPYQADIALDNLNK
GTMPNSLKVTIKPGYTVGVGFYSNFKFLSGKYYVAIVRAKVGNATDAGISAPNALVESKV
IVKDKTKFATAWFRLAPTSDIITNIDLVTQGTVGQYSYFEAARIYEISAAEYTALATMTD
EQIDTKYPYVDSVMPVRNPYAIRYGENLIPPFYEWTLGERAKVINPYKLETVATVSVDQS
NVYVPVVPGTTYTLTVKVNGRVTVVETDDTGLETTVYSTTDNENRIVTVTFTTKTTTKRV
RIYATNTGAGTYTLENPMLNIGSMAKPFKPCEHSMLALQTDLYADPVTGGNADTVFEQDG
QYFKAKKWKGITLDGSRAWVLGDAAATAGVRQVKVVALAAGAVAASGTGTKFDGKVLPQG
STGNTADTNAVTAAGDIYIGVSMADSGWADSYSPAQDDIKAYFYGWKVYDAGTFTPTQAQ
AATTATWNGTGAKYYVPRVGSANPVASVPVTSYAGYTPYQLVYQLATPTVEPVASEGQLS
FVEGDNQVEVGTGIVLREVVKLDDRDPVSVYINSINSGTRFQYPSGKILSIYKNGAEDFS
WYKGTYVYSGEFYAYGQIARSNFDQTSTYSATYLMLDKPPVVSFIGSYAANEKTLLLDLI
DNIRQNTARVSVLESKKADKDSPAWITPTLLSGATPETDANKPQYTKMSDGMVLFRGAIK
VPISGDVLLFNLPPEFRPSAPYTVISCWVSSSTHGQEAEGIVIRSDGSVRGNLKYVYDNW
IRLDSIRFPTN
Download sequence
Identical sequences E3EGR9
gi|386039758|ref|YP_005958712.1| WP_013369785.1.14980 WP_013369785.1.41886 WP_013369785.1.91857 gi|310640636|ref|YP_003945394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]