SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310641018|ref|YP_003945776.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310641018|ref|YP_003945776.1|
Domain Number 1 Region: 222-354
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-20
Family Histidine kinase 0.0074
Further Details:      
 
Domain Number 2 Region: 129-210
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000049
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310641018|ref|YP_003945776.1|
Sequence length 356
Comment two-component sensor histidine kinase yvrg innvolved in cell wall processes (yvrh) [Paenibacillus polymyxa SC2]
Sequence
MNSLVKISFRFIKVTLCFALAYVLCFLICTVIYIFIKSTFGTSHNMNIDLFWIGLGIVQS
IVFIAVYGWYIGKPLVYVIKWIGNIATGEFQAPLSELELPERKKNQSNNYKPPYQLYKEV
FEQMNILSAQLRSNEEERMEIEKRKQQWVAGVSHDLKTPLSYIEGYAAMLTAQEYDWSEE
EKRSFSMAISEKVTEMKQLIQDLNASMQLKEGALPIQLKKEDIVEFLRNTVIDIANHPSA
EQYEFSFMSLEAVCVVPFDSKLLGRALKNFLMNAIIHNPPGTHVSMEVNKESDKLHISIE
DDGIGMNPTEFIQMTPSKEHGIPIAKSFIEAHNGTLHILPGSQEGTRIEITLPLNM
Download sequence
Identical sequences E3EFP4
WP_013370162.1.13814 WP_013370162.1.14980 WP_013370162.1.31500 WP_013370162.1.57060 WP_013370162.1.6267 WP_013370162.1.91857 gi|310641018|ref|YP_003945776.1| gi|386040107|ref|YP_005959061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]