SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310641473|ref|YP_003946231.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310641473|ref|YP_003946231.1|
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.53e-24
Family BT2961-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310641473|ref|YP_003946231.1|
Sequence length 212
Comment lipolytic protein g-d-s-l family [Paenibacillus polymyxa SC2]
Sequence
MAYHYTAIGDSLTTGAGTLLSGGFVPVYRRMAERHLRTPVSYENLGINGLTSQELLSMVR
NNPLFRSAISRAELITVTIGGNDLRPYISTLAGSPGASGSSISQALNHTKEHVRQIVHAL
YQIKSGQREPFIIRMVGLYNPFPGVREAGVYVRQYNSFLYTLGGPNYRVANIYPIFEGNE
RALLSLDRIHPNSRGYRVIAEELNRLGYAPLR
Download sequence
Identical sequences E3EIX1
gi|386040507|ref|YP_005959461.1| WP_013370607.1.13814 WP_013370607.1.14980 WP_013370607.1.91857 gi|310641473|ref|YP_003946231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]