SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310641568|ref|YP_003946326.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310641568|ref|YP_003946326.1|
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily CheW-like 1.44e-38
Family CheW-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310641568|ref|YP_003946326.1|
Sequence length 153
Comment chemotaxis protein CheW [Paenibacillus polymyxa SC2]
Sequence
MGEEIKVIVFKLGEEEYGVEVEKVQSIERMVPITRVPRTYDFVKGVFNMRGVVIPVIDLR
GRFGLPEAEYTDQTRIIIVAVGEMQVGFIVDSANDVIDLNTDNIETPPEVVGGVKAKYLR
GVAKIGEERLLIMLNLSEVLNRSEMNQLEGLED
Download sequence
Identical sequences A0A0F0G7U4 A0A161RZ02 E3EG52
gi|386040598|ref|YP_005959552.1| gi|310641568|ref|YP_003946326.1| WP_013370696.1.13814 WP_013370696.1.14980 WP_013370696.1.15730 WP_013370696.1.16985 WP_013370696.1.21650 WP_013370696.1.29540 WP_013370696.1.30741 WP_013370696.1.31500 WP_013370696.1.36933 WP_013370696.1.40264 WP_013370696.1.41886 WP_013370696.1.57060 WP_013370696.1.59813 WP_013370696.1.6267 WP_013370696.1.6878 WP_013370696.1.71998 WP_013370696.1.78809 WP_013370696.1.88866 WP_013370696.1.91857 WP_013370696.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]