SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310641861|ref|YP_003946619.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310641861|ref|YP_003946619.1|
Domain Number 1 Region: 199-364
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.49e-35
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 127-210
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000122
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 89-131
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000183
Family HAMP domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310641861|ref|YP_003946619.1|
Sequence length 368
Comment sensor histidine kinase vans [Paenibacillus polymyxa SC2]
Sequence
MKAKRYDTLGWKLAALSLAAFTLTGLILMVFYYGASLLLWLNPSRSFFGTRLIRWTVNHI
GSSLIMLVSGLPLYIYFFFLFTKNTIGYLREITKGMQKFADGNLSYSIPVSSADELATLA
KNMNTMADKLRLSLEEERASAKAKNDLITGVSHDLRTPLTSVIGFLEYIETDRYRDEMEL
RYYVNIAYEKSLTLKKLIDELFEYTRVSGGSLPLELKPVDLGKLLTQLAEEFVPSLEQAD
MSYRVRIVEPVRILADTDELVRLYENLFSNAIRYGKDGKRFDITIGREGDEAIVICTNYG
APIPQEDVPHLFERFYRVDKSRSKETGGTGLGLAITKSITELHNGRISVRSSRRQTDFET
RFPLYRAR
Download sequence
Identical sequences E3EJ91
gi|310641861|ref|YP_003946619.1| gi|386040856|ref|YP_005959810.1| WP_013370983.1.14980 WP_013370983.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]