SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310641865|ref|YP_003946623.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310641865|ref|YP_003946623.1|
Domain Number 1 Region: 181-381
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.73e-50
Family YxiM C-terminal domain-like 0.000000152
Further Details:      
 
Domain Number 2 Region: 34-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-37
Family YxiM N-terminal domain-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310641865|ref|YP_003946623.1|
Sequence length 386
Comment esterase yxim [Paenibacillus polymyxa SC2]
Sequence
MKWKKGLTGMLLAAFLCGAPGVGIATPAHASNGEYKFDFGGGTVETGYTGVSASLSYDSA
RGYGFRTPENMRNVSASGTGVASDAVQFLTTGTKSENTFDVDLPPGLYEVSVTLGNTSRS
SVAAEGVYQIINMTGNGAKDRFQIPVTDGQLNLLITEGKEGAVFTLSALEIRQLSSNPAT
NRTIYIGGDSTVCNYYPLDSSVQAGWGQLLPEFVNTNTFQIRNMASGGQIARGFHQDGQL
EAIVQYIKPGDYFILQLGINDTNPKHNESEAEFKDWMRDMIRQVKAKGATVILSTPQGRA
TDFNANNVHNAENRWYRSAILALAQEEQTPLVDLNVLSSAYFTSIGKEATLALYMNGDTL
HPNFAGARQLARLVAHDLKRQGLSGF
Download sequence
Identical sequences E3EJ95
gi|310641865|ref|YP_003946623.1| gi|386040860|ref|YP_005959814.1| WP_013370987.1.14980 WP_013370987.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]