SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642059|ref|YP_003946817.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642059|ref|YP_003946817.1|
Domain Number 1 Region: 19-63
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000136
Family Family 36 carbohydrate binding module, CBM36 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310642059|ref|YP_003946817.1|
Sequence length 64
Comment arabinoxylan arabinofuranohydrolase [Paenibacillus polymyxa SC2]
Sequence
MGPFTYKGHFLKNPYTFFGVGGTYAGKISAPFDGVALYANAEYASYSQYFANSMHNISVR
GASI
Download sequence
Identical sequences gi|310642059|ref|YP_003946817.1| gi|386041035|ref|YP_005959989.1| WP_013371180.1.13814 WP_013371180.1.14980 WP_013371180.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]