SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642108|ref|YP_003946866.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642108|ref|YP_003946866.1|
Domain Number 1 Region: 178-347
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.42e-32
Family Histidine kinase 0.0034
Further Details:      
 
Domain Number 2 Region: 105-185
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.1e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|310642108|ref|YP_003946866.1|
Domain Number - Region: 71-117
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00209
Family HAMP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310642108|ref|YP_003946866.1|
Sequence length 350
Comment sensor protein [Paenibacillus polymyxa SC2]
Sequence
MKLKIKLPLLFLVMFIVFMVSIGIYLKFIFAAYSPISSSLLNPSYIGLLFPIFAIACFIF
IILIMYIYFFIEKPIGLLNTRLERINIVHPLPPLALRSNDEIGDLYNHFNKMEKRLQLAH
KEQTDIIAAIAHDLKAPLTSINGFAELLAMQKGLSENEKQEYYELIQKKSKYMAELINDF
VSFTKEKQDLESMTVKPVDASKLFENIALEYEYELSGLDCELVYKHLFTGNVMLMVNEIM
IGRVFGNLFSNVVRYGRKNELKVYMTGYSQGSYAYIEIEDNGTGVPDKDISSLFLKFFTV
DKSRQIENGGIGLGLASCKSIIEHHGGEIYAYSSEYGGLGIKFSLPLAKH
Download sequence
Identical sequences E3E485
WP_013371229.1.14980 WP_013371229.1.91857 gi|310642108|ref|YP_003946866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]