SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642162|ref|YP_003946920.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642162|ref|YP_003946920.1|
Domain Number 1 Region: 262-566
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.98e-75
Family beta-glycanases 0.0000718
Further Details:      
 
Domain Number 2 Region: 6-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.74e-33
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0069
Further Details:      
 
Domain Number 3 Region: 162-261
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000234
Family beta-Galactosidase/glucuronidase domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310642162|ref|YP_003946920.1|
Sequence length 578
Comment beta-galactosidase [Paenibacillus polymyxa SC2]
Sequence
MIRTFQQHRLRESQQLDGLWDFVFDKNNVGLSEEWNTNFPSNYDRVPVPGCWNNELGKYE
YEGVAWYRTWVTLDNPSHLRLLFHAVMGHADVYWNGQHLGYHYGGFTPFDFTIQDVTSGV
HELIVRTDSTLGTNTLPYHIVDWFHYGGIIRPVEVQLLPDVWIEGMRITYEMTGDSSADV
RILLKLCSMSDKPVEVPVSLYRNNEMFQSDSAYLSAKGSTELVLEQAWSDLQRWDTDDPA
LYMIRAVVGQDDRTDRIGFRTVETRDKKILLNGKELYLQGVNRHEEHPEWGFAFPNKLMT
KELGIIRQMGCNTIRGSHYPQSEYWIDLLDEQGILFWSEIPIWGAAFPAEETDDPLFVER
ALTMMDEMIERDFHHPSILFWSVHNEIDTRSQQAYDLSVKMTELVRSKDQSRLVAFATMH
PMTDICLGLFDVIGINYYGGWYFGHVEFEEMLEAFHERCNEYGAEYTPVLMTEFGGAGVY
GDSGWEPRLFSEDYQADLLGKSLKLFRSDPKISGTYVWQFADTRGQLLSHQPHFRDRARS
FNNKGLVNEYRKPKLAYRVVKGIYTDHSDPYDWGSTLK
Download sequence
Identical sequences E3E4D9
gi|386041125|ref|YP_005960079.1| WP_013371283.1.14980 WP_013371283.1.91857 gi|310642162|ref|YP_003946920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]