SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642599|ref|YP_003947357.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642599|ref|YP_003947357.1|
Domain Number 1 Region: 300-472
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-46
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 227-311
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.65e-22
Family Homodimeric domain of signal transducing histidine kinase 0.00072
Further Details:      
 
Domain Number 3 Region: 115-235
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000593
Family N-terminal PAS domain of Pas kinase 0.057
Further Details:      
 
Domain Number 4 Region: 72-120
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000981
Family HAMP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310642599|ref|YP_003947357.1|
Sequence length 484
Comment sensory histidine protein kinase [Paenibacillus polymyxa SC2]
Sequence
MNFWRSLVGKLWITIICLVGSVLIFLGLFLLPYINRNFAAHESTEIKHLFTYTCIVGFLL
TTFFALFLFTKITQPMQLLIQAANAIREGRYDTRLSLVTSDEIGELAKTFNHMSTELEAT
IRSLNEEKNHLSSVLRSMSDAVFTFDRSGQIILTNPPAQSLLDIWKKLEWQGRDLEEFGA
SVPEPLLPLFHTVMDRGEDVGDYIHVKKGSWSVQMAPLYTDNAIRGAVAVLRDITEEVKL
EKMRSDFVANVSHEIRTPLSMMQGYSEALLDGMAGSPEESEELVQVIHDESLRMGRLVKD
LLDLARMEAGHTDMYRQEVDVNELIERVHRKFTVRSKERGLILDYYEPDQHLLLPEADED
RLEQVLTNLLDNAFRHTPSGKKVTIAADQIRGERNELIRIRIKDEGVGIASEDLPYIFDR
FYKADKARVRGEDKGTGLGLAIVRNIVEAHGGSVSAASVLGEGTEFTILLPISNKTRQGS
VTSL
Download sequence
Identical sequences E3E803
WP_013371712.1.13814 WP_013371712.1.14980 WP_013371712.1.91857 gi|386041660|ref|YP_005960614.1| gi|310642599|ref|YP_003947357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]