SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642810|ref|YP_003947568.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642810|ref|YP_003947568.1|
Domain Number 1 Region: 10-378
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.52e-116
Family Amylase, catalytic domain 0.00000124
Further Details:      
 
Domain Number 2 Region: 406-621
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 6.87e-60
Family A4 beta-galactosidase middle domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|310642810|ref|YP_003947568.1|
Domain Number - Region: 637-691
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00396
Family alpha-Amylases, C-terminal beta-sheet domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310642810|ref|YP_003947568.1|
Sequence length 695
Comment glycoside hydrolase family 42 [Paenibacillus polymyxa SC2]
Sequence
MTYSNITKYPPISKRVPRMLHGADYNPEQWQQYPEVLAEDIRLMKLAKCNVMSVGIFSWV
SLEPEEGVFTFEWLDRILDSFAENGIYAFLATPSGARPAWMSQKYPEVLRVEANRVRNLH
GFRHNHCYTSPVYREKVRIMNTKLAERYANHPAVIGWHISNEFGGDCHCDHCQEAFRAWV
QDKYGALDKLNHAWWTTFWSHTVTDWSQVESPAPHGETQVHAMNLDWRRFVTEQTADFIK
HEIVPLKAENPDIPVTTNLMEFFEGLNYWKFADLLDVISWDSYPTWHDREGDDSRQAARV
AMMHDIIRSIKGGKPWMLMESTPSLTNWQDVSKLKRPGMHLLSSLQAVAHGSDTVQYFQW
RKSRGSSEKLHGAVVDHVGHEHTRVFGDVTDVGHALEKLEEVIGTSVPAEAAVIFDWENR
WGINDSQGPRNKGVKYEETAEAHYLALWEQGVPVDVIHMDADFSKYKLLVAPMLYMVRSG
VGERIQKFVENGGIFVATYWSGIVDEHDLCFLGGFPGPLRKTLGIWSEEIDGLHDHDRNY
IIPVEGNELDLQGEYEAVELCDLIHTEGAEVLAEYGADFYAGRPALTVNRLGQGKAYYIA
SRNTGLFHSHFYKSLIDDAGLSKALDVQLPHGVNTAIRTDGVHDYIFVMNFTHEPQKLTL
DGRTYSDLLENHVIADSSVQLGAYAVKVLKAERNN
Download sequence
Identical sequences E3E8D5
gi|386041888|ref|YP_005960842.1| gi|310642810|ref|YP_003947568.1| WP_013371913.1.14980 WP_013371913.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]