SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310643896|ref|YP_003948654.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310643896|ref|YP_003948654.1|
Domain Number 1 Region: 162-326
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-34
Family Histidine kinase 0.0047
Further Details:      
 
Domain Number 2 Region: 99-170
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000726
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310643896|ref|YP_003948654.1|
Sequence length 328
Comment two-component sensor kinase yxdk [Paenibacillus polymyxa SC2]
Sequence
MKLFWRDHFSMIIFNIIQLFLVLSIYWMDGYRNLSTALYSVFFGFILLLVYLLFRYVMYS
GLYRILSTANIRDLDELIQMKVLNPLASSLQHLLLQFYQLYQSRIHQLEHQQRDHITFIN
QWVHQMKTPLAVIHLILKGKIDPESDQIHDEIDRMGKGLDMILYMSRLESFEPDFHVEPV
VLRKLVSEVIYDNKRLLIRNEIYPSNEVDEQLNVITDAKWLRFIINQLVTNAIKYSSGYA
HSLKLISDVRDHVIVLKVQDEGIGIPKKDIERVFEAYYTGENGRKYSESTGMGLYLVAEI
CKRLNHDIQLTSTVGEGTTVEILFPIHP
Download sequence
Identical sequences E3EB81
WP_013372982.1.14980 gi|310643896|ref|YP_003948654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]