SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644053|ref|YP_003948811.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644053|ref|YP_003948811.1|
Domain Number 1 Region: 141-301
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-34
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 86-151
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000011
Family Homodimeric domain of signal transducing histidine kinase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310644053|ref|YP_003948811.1|
Sequence length 305
Comment sensor protein [Paenibacillus polymyxa SC2]
Sequence
MTTLLYICIGIAVAAVCTAVVAIMLYRRSIQRTMKTIENMLDAAINGSFSEDVFDESVLS
AIEAKFAKFLSICSVSSKNLLAEKNKINELISDISHQTKTPVANILLYSQLLSEYELSQD
TSTCVKALSAQAEKLNFLIQTLLKTSRLETGIITVAPRRESVQKLLDAALEQMMPKADAK
GISVVMEDTVTHAYFDLKWTSEAVYNIMDNAIKYTETGGSMNIKVTAYDLFCRIDIIDSG
IGIAEEEQGKIFTRFYRSPTVNSQEGVGIGLFLAREIIAAEGGYIKVRSRYGRGSTFSIF
LSMDT
Download sequence
Identical sequences E3EAF2
gi|310644053|ref|YP_003948811.1| WP_013373137.1.14980 WP_013373137.1.91857 gi|507717274|ref|YP_008049883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]