SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644058|ref|YP_003948816.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644058|ref|YP_003948816.1|
Domain Number 1 Region: 30-92
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000804
Family Homodimeric domain of signal transducing histidine kinase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310644058|ref|YP_003948816.1|
Sequence length 150
Comment sensor protein [Paenibacillus polymyxa SC2]
Sequence
MLSSVETRLAQFLSICSVFSTNLLVEKNKINKLISDISHQTKTPVANILLYAQLLSEHDL
PEDSSSCIKALASRAEKLNFLTNTLVKTSRLKVGIITVSPRQESVQELLHVAREQMIPKA
DTKDISIVMENTPIHTCFVLKWMAVLWTML
Download sequence
Identical sequences E3EAF7
gi|310644058|ref|YP_003948816.1| gi|507717277|ref|YP_008049886.1| WP_013373142.1.14980 WP_013373142.1.40264 WP_013373142.1.6267 WP_013373142.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]