SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644095|ref|YP_003948853.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644095|ref|YP_003948853.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily CheW-like 1.26e-17
Family CheW-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310644095|ref|YP_003948853.1|
Sequence length 137
Comment chemotaxis protein CheW [Paenibacillus polymyxa SC2]
Sequence
MSEFIVCSLADKKFALNFLEVEEVMNAKKGTPLPFSEAWHEGMVTIRGDVFTILNLRKKL
LLPASSDSSEDKMILLSRAKIALLVDQVEDTASAEDSQLQNNEEEWQRELFPTVMEHRGA
LIPVIDMDAFLASTKTN
Download sequence
Identical sequences E3EBD8
gi|507717312|ref|YP_008049921.1| WP_013373179.1.14980 WP_013373179.1.31500 WP_013373179.1.91857 gi|310644095|ref|YP_003948853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]