SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644282|ref|YP_003949041.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644282|ref|YP_003949041.1|
Domain Number 1 Region: 805-1109
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.76e-63
Family beta-glycanases 0.00031
Further Details:      
 
Domain Number 2 Region: 1220-1370
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.89e-49
Family Cellulose-binding domain family III 0.0000182
Further Details:      
 
Domain Number 3 Region: 91-476
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.52e-25
Family beta-glycanases 0.052
Further Details:      
 
Domain Number 4 Region: 592-672,1115-1203
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-16
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 672-792
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000935
Family Family 6 carbohydrate binding module, CBM6 0.084
Further Details:      
 
Domain Number 6 Region: 472-568
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000528
Family alpha-Amylases, C-terminal beta-sheet domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310644282|ref|YP_003949041.1|
Sequence length 1373
Comment cel44c [Paenibacillus polymyxa SC2]
Sequence
MERHSYGVLLFSNVKEESGMRAKNSSNLLFKRSKWLPVVMACTMLVGGALPAPTVVHGQT
AKTITIKVDTSKDRKPISPYIYGTNQDLTGDENMAARRLGGNRMTGYNWENNMSNAGSDW
QQSSDNFLCNNGGLTGAECEKPGAVTTSFHDQSLKLGAYSLVTLPMAGYVAKDGNGSVQE
SEKAPSARWNQVINAKNAPFQLQPDLNDNRVYADEFVHFLVNKYGAASTKTGVKGYALDN
EPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAVDAGAEIFGPVLYGFGAYKDLQTAP
DWDSVKGSYSWFVDYYLDQMRLSSQAEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETK
QARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGEND
ISGGIAMADVLGIFGKNDVYMANYWKLKDGANNYVSAAYKLYRNYDGKNATFGDTSVSAQ
TSDIVNSSVHASIANASDKELHLVVMNKSMDSAFDAQFDLSGEATYGSGKVWGFDKNSPQ
IKEAAPITQISGNRFTYTVPPLTAYHIVLTAGKDTSVPPVENPEGFKLKAEAGDGQVHLS
WDASNGVVGYSVQRATDENGPFTTVVASLIETSYTDTNLTNGSSYYYKVTAKTNKGTSES
NVLKAVPKVSVNDPVRYEAEDGTLKGTIVESSGTGYSGTGYVTNFHNAGDSLTMTIQAPT
AGLYNLTIGYRSPHDDKRTNFSLNGKAFGELVLGKTADFKETSGGKLLLNAGANTIGFET
GWGWYDIDYVRLEPAADRPPHAVTKTLTNPNATVEAKALMNYLVDQYGKNMLSGQEEINE
IDWLQANVGKKPAIAALDLIDYSPSRAEHGLSSTEAEKAIAWDKQGGIVTFAWHWNAPKG
LIDTQGKEWWRGFYADSTTFDIEYAMSHPESEDYKLLIRDIDVIAAQLKKLQDAKVPVLF
RPLHEAEGKWFWWGAKGPEPVKKLYILMHDRLTNVHKLNNLIWVWNSVAPDWYPGDEYVD
ILSFDSYPQAGDYSPQIAKYEDLVTLGKDKKLVAMSENGPIPDPDLMKAYQAHWSWFATW
YGDFLRDGKQNSLEHLKKVYNHPNVITLDELPTNLKTYGITEQPSVPGSFTLNAAGETAK
VSLSWTASANAKSYEVKRSTAENGAFATVVSDVYGSSYTDTAVTADTTYYYQVVAKNDAG
QTLSNTASAAPKADTQQPTTGLLLQYRTADTKVNDNHLNPHFQIVNKGTASVPLNELKIR
YYYTIDGDREQTFNCDYAALSCSKLNGKLVKMEKAATSADYYLEVSFNSDAGVLAPGGST
GEIQTRIHKTDWSNYNESDDYSYKGTQSSYADHVKATLYQNGVLVWGTEPIAN
Download sequence
Identical sequences gi|310644282|ref|YP_003949041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]