SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644496|ref|YP_003949255.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644496|ref|YP_003949255.1|
Domain Number 1 Region: 13-353
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-83
Family NagZ-like 0.0000231
Further Details:      
 
Domain Number 2 Region: 355-422,560-707
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 2.88e-49
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 837-964
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000146
Family Family 6 carbohydrate binding module, CBM6 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310644496|ref|YP_003949255.1|
Sequence length 976
Comment glycoside hydrolase family protein [Paenibacillus polymyxa SC2]
Sequence
MTDLSHETTGIEYLFQDPKIHLDERVRDLVSRLTLEEKIESMLQYQPAIDRLGVAAYKHG
TEAAHGIAWLGEATSFPQPVGLACTWDTELMRQIGSVIADEARVYYRRDPKLNGLTLWAP
TVDMERDPRWGRNEEAYGEDPYLTGELSKELVKGIQGDHPVYLKAVATLKHFLGNNNEVD
RGVGSSSIDPRNLREYYLRAFEKPFTEGGAQSMMTSYNLINGTPATLYHGVNDIVRGEWG
MDGFVVSDAGDVMGIVNDHQYYDSHTPGVAESIRAGIDSITDDAELSKQAIREALEQGSL
QEEDLDRALFHTFRVRFRLGEFDPAADNPYASIGEEALMTEQARELSLRAAREQIVLLKN
EQEFLPLNPAQCGKVAVIGSHGNEVFRDWYSGTLPYRVTPLEAIRAKLESGGAEERVVYS
DAKDRVTLTAATDGVKITVNSSGDMRLSQNGEPTVLTITDWGYGSVTLHDEHLGTYVTSD
EETLRVTADEAYGWYVKEVFGLTPVEQGEHLWTTWNGKSVIAGTEGLLKVMESASPAPNA
SDFNHTTFRIETVSDGLAEAIAAAQAADTAIVFVGNHPLINGKEENDRPGLELAASQQRL
IEEVYRVNPNTIVVLTGSYPFAIPWLQEHIPAIIYTSHAGQEHGTAIADVLFGDYAPAGR
LNMTWVQSEDQLGDIKDYDIIRSGRTYQYFEGEPLYPFGHGLTYSPFEYSDLHTDAHKDN
VKSMATLDAADTLQVRVDVTNRGESAGEEVVQLYVRSGASRVKRPLKTLCGFQRIRLEPG
ETRTIIFTVRVKDWAIWDVTRDGYCVESGEYTLLAGASSADIRLEHPVYVRGEVIPPRQA
GPRIRAENFDDCFDILLDESKEQKEACVRPRSPQRSGWIAFHGVDMNTVSVVELQCRVSG
NSSDAAIELHLDAPDSPAVSRINVGNTGGAQAWVTLSEKVQSASGIRDVYLSLSGEVRLG
HFTLGARDPEGSGFQA
Download sequence
Identical sequences gi|310644496|ref|YP_003949255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]