SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644530|ref|YP_003949289.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644530|ref|YP_003949289.1|
Domain Number 1 Region: 100-299
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000000000122
Family DPP6 N-terminal domain-like 0.046
Further Details:      
 
Domain Number 2 Region: 346-455
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000645
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310644530|ref|YP_003949289.1|
Sequence length 470
Comment von Willebrand factor A [Paenibacillus polymyxa SC2]
Sequence
MKGILICIVALLILSACYHSDESSQIQSTAHKSEVAQTTNDNKIVMPTNWILFRGENDNE
PIEYLENMDDLNGDDIINTDSIIDKLYVSEKGDYPKDELYINGILFNGSHIILCRESHDS
NYLMVKIFNLSTLQKTIEFNIPVTTDYFLISPDLKRCVYAENGVLYQYIIKEKSAKKLAD
LYNHVTGFANLKNPKFSPDSMKLCLQSNSYLVFYDLVNNKKVKQVSMGTEGIWIEQWLYN
DLLLYSSSSNNKTYLLDLKNGNKRVLADVTGSLTLTMDGKRMVYLNSQKEIEQHHINTGQ
SVKYFDVMQRLGYSVAPVQWIQTTTDLMKYRKSIPAQKIVASSTLPDQAGNSYAARNIMD
GDVSTAWCEGVKGDGIGEWIKIDFGSMQELKGFELINGLAKSSKAFQANNRVKRMKLEFS
NGQTMMIDNDFISNQFLDNPIHTSFVKITIEAVERGSKYHDTCMSEIRFF
Download sequence
Identical sequences E3EAY4
WP_013373583.1.14980 WP_013373583.1.91857 gi|507717712|ref|YP_008050321.1| gi|310644530|ref|YP_003949289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]