SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644662|ref|YP_003949421.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644662|ref|YP_003949421.1|
Domain Number 1 Region: 101-384
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.31e-52
Family alpha-L-arabinanase-like 0.0033
Further Details:      
 
Domain Number 2 Region: 393-531
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-26
Family Galactose-binding domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310644662|ref|YP_003949421.1|
Sequence length 532
Comment coagulation factor 5/8 type domain-containing protein [Paenibacillus polymyxa SC2]
Sequence
MPDKPFWPILSVLKEADDIVKWISNSKSLAAWICIILAVVGAGLQPDAVHANTTGVTQAT
YGSEMNPSLNGIDAANAELSLNAIASTAITNGTDWKDTAGNPIQANSGNILKVGSTYYWY
GEHAENWKFEKVNVYTSTDLKNWSFRSSILTKDSAPELNSSKIERPKVIYNKSTGKYVLW
AHYENGTDYSLGRVAVATSDTPDGNFTYQGSFRPLNYESRDMTVFTDTDGSGYLITASRK
NGGANDTMAIFKLTADYTGVQSFVGWIFENGYREAPAVVKKNNTYYLFTSQASGWYPNQG
AYATASSMTGSWSALSPFGDPAAYGSQIHSIATITGSTGTSYIYMGDRWNPLNLSDHKFI
WLPLTLNDSNKTATLNWYSSWDLDAATGKVILPSLVNHAQGKTATASSAASASPASLAND
GNPQTSWKATSASWPAWWQVDLGSTKTISEVDISWFMYKGSEAYYKYKIEYSTDGVHYST
IDRTSNTTYGFTSDKVNFQARYVRINLVNAVLFNNPNNWYTPTVHEVRLLGH
Download sequence
Identical sequences gi|310644662|ref|YP_003949421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]