SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644748|ref|YP_003949507.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644748|ref|YP_003949507.1|
Domain Number 1 Region: 175-323
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-31
Family Histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|310644748|ref|YP_003949507.1|
Domain Number - Region: 114-158
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0012
Family Homodimeric domain of signal transducing histidine kinase 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310644748|ref|YP_003949507.1|
Sequence length 334
Comment two-component sensor histidine kinase controlling resistance to antibiotics affecting the envelope (ytsa) [Paenibacillus polymyxa SC2]
Sequence
MIKKYLRERLSWILLFVCQQFLILFIAYVDAAIPLMPILYIVFLSMMIFLVFLIIRYLKE
TKFYTTLEEWESPLELTGIGEPESPFEQIIEQKITDQTERLQQIISQNQLTLEHEKDELL
SWIHEVKTPLTTMHLMIERLDDKSLKAQLTYEWLRIHLLLDQQLHHKRISFIENDLYVEQ
VDLKSLVFKEIKALQSWCIQKGIGFDIRLEQMEVLSDAKWLAFIIRQLLTNAIKYSDASD
IIIHSYEQRDRIQLEVQDFGRGIDPKDIPRIFEKGFTSTTQHSDHTSTGMGLYLTKKAAQ
SLLIHIDVHSKPNMGTTFTLIFPKRNDFVSMMSM
Download sequence
Identical sequences E3E959
gi|310644748|ref|YP_003949507.1| WP_013373799.1.14980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]