SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640218|ref|YP_003944976.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640218|ref|YP_003944976.1|
Domain Number 1 Region: 57-374
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.23e-77
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000867
Further Details:      
 
Domain Number 2 Region: 373-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-27
Family Glycosyl hydrolases family 32 C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310640218|ref|YP_003944976.1|
Sequence length 530
Comment endolevanase, glycoside hydrolase family 32 [Paenibacillus polymyxa SC2]
Sequence
MRKKAPKNIWIRSVVVITGLTIFIAMGWNMYQQDAGKPPKPAATPKNQANQSKHTTPTYR
AAYHFTVPDKWKNDPQRPIYMDGEYHYYYLYNRDYPHKNGTEWRHATSTDLVHWKDEGVA
IPKYTNPNGDPWSGSVVIDDHGTAGFGKGALVAIVTQPSADGGKQEQFLWYSKDKGKTFT
SYRNKPVMSNPGTKDFRDPKIVRDTGRNQWVMVMAEGTKIGFYKSKNLKDWQFTSGFQTE
NIGLVECPDLYQMRADDGTYQWILGASANSKPTGGPNTYAYWTGDFNGEAFLPDRNDPDW
LDYGFDWYGAVTFEDGKAKDQYSHRYALAWMNNWDYANNTPTLKEGFNGMDSVVRQIRLK
RTSDVGYRLVSQPVPALEQFPVATESLGKIQVDGTHTLPIAGDAYQLEADVSWSTIKNTG
LRLRESADGKRHVDVGVSVEGQYSYVNRANTGQPDQSGKYVESKAPFDINKKNVHLKILV
DKTSIEVFVDDGEVAYSSLIFPRLEDRGITLFSDGGKAIFNNVVIKHFSH
Download sequence
Identical sequences E3EI67
WP_013369371.1.14980 WP_013369371.1.91857 gi|310640218|ref|YP_003944976.1| gi|386039389|ref|YP_005958343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]