SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310640575|ref|YP_003945333.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310640575|ref|YP_003945333.1|
Domain Number 1 Region: 33-213
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.57e-57
Family NodB-like polysaccharide deacetylase 0.000000995
Further Details:      
 
Domain Number 2 Region: 240-356
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-54
Family Family 36 carbohydrate binding module, CBM36 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310640575|ref|YP_003945333.1|
Sequence length 357
Comment endo-1,4-beta-xylanase B [Paenibacillus polymyxa SC2]
Sequence
MSIAKLGKWTAIMSITVSLFTGSLVISNNQAHAADCSNGYVALTFDDGPNPSNTRALLSA
LKQNGLRATLFNLGQNAQNNSSLVREQQAAGMWIGNHSWSHPHMTQLSASQMSSEITRTQ
QTIQSITGTAPKLFRPPYGETNGTLKSIENQNGLTEVLWNVDSQDWNGASTAQIVAAASR
LKNGDVILMHDQYQTTLQAIPQIAQNLKNRNLCSGMISPSNGRAVAPDGKNNETPPNTST
KIEAVNMTKSGQYTSNISSPFNGVALYTNNDSVKFTQNFTSGTHSFSLRGASNNSNMAKV
DLKIGGQTKGTFYFGGSSPAVYTLKNVNHGTGNQKIELVVTADDGTWDAYLDYLEII
Download sequence
Identical sequences E3EFC9
gi|386039703|ref|YP_005958657.1| gi|310640575|ref|YP_003945333.1| WP_013369725.1.13814 WP_013369725.1.14980 WP_013369725.1.31500 WP_013369725.1.41886 WP_013369725.1.57060 WP_013369725.1.6267 WP_013369725.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]