SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310642198|ref|YP_003946956.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310642198|ref|YP_003946956.1|
Domain Number 1 Region: 496-785
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.65e-72
Family beta-glycanases 0.00000000162
Further Details:      
 
Domain Number 2 Region: 254-393
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.26e-42
Family Ricin B-like 0.0013
Further Details:      
 
Domain Number 3 Region: 32-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.17e-33
Family Galactose-binding domain 0.018
Further Details:      
 
Domain Number 4 Region: 162-252,395-488
Classification Level Classification E-value
Superfamily Fibronectin type III 5.63e-27
Family Fibronectin type III 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310642198|ref|YP_003946956.1|
Sequence length 802
Comment mannan endo-1,4-beta-mannosidase (beta-mannanase) (1,4-beta-d-mannan mannanohydrolase) [Paenibacillus polymyxa SC2]
Sequence
MKKTITCLILFGLLMSMLPFKNVSAFENARLTQSATASSVEDSSKAADFAIDGDPQTRWS
SQYSDPQWISVDLGSTTKINGVTLNWEAAYAKSYQVQTSTDDDHWTTVYSTTTGDGGIDK
ISFEVTDARYVKMNGIERATSYGYSLWEFEVHSADEPEDNSPPTAPSNLTSSSVSDTTVS
LQWTESTDNVGVSSYDIYKGSDLVGSSASTSFIVTGLTANMAYSFYVKARDTAGNVSDAS
NVIDVTTSAADTNIVSGETYKLTAQHSGKNLEAGDSTADGAKVQQWTNNGSARQRWKVID
VGDGYYKLIVQSSGKALTVVGGSSEDGASVQQWTDSDLTNQKWKMIDVGGGYYKLLVQSS
GKALDVIGGYTNDGANVQQWTDNGNDQQKWKFTLVDSTPDTTAPTAPANLKSYSKTNTSV
SLVWTASTDDVDVTSYDVYNGTTLVDSTPTTSYTVTGLSANTTYSFTVKARDAAGNISTA
SNVLKVTTNSTTENTGFYINGTTLYDAKGNPFVMRGINHAYTWYKGQESVAIPAIAKTGA
NTIRIVLSDGQQWTKDDLSAIQNLITLSEQNKLVVVLEVHDGTGSDSATVLDNITNYWIE
MKSALIGKESTVILNIANEWYGTWDGGGWAQGYKSVIPKLRNAGIKNTIIVDGAGWGQYP
QSIFDYGKEVFNADPLKNTMFSIHMYEYAGGNAATVKSNMDNVLNKNLALLIGEFGIKHT
SGDVDEATIMSYAEQKGVGYLAWSWKGNSPGLDYLDMTTDWQGSSLTEQGRIIIEGPNGI
RATSKLSSVYSDSSNKQSSSKP
Download sequence
Identical sequences E3E630
WP_013371319.1.14980 WP_013371319.1.91857 gi|310642198|ref|YP_003946956.1| gi|386041156|ref|YP_005960110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]