SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310643441|ref|YP_003948199.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310643441|ref|YP_003948199.1|
Domain Number 1 Region: 50-339
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.16e-90
Family beta-glycanases 0.00000000403
Further Details:      
 
Domain Number 2 Region: 383-534
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.94e-50
Family Cellulose-binding domain family III 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310643441|ref|YP_003948199.1|
Sequence length 534
Comment endoglucanase celv3 [Paenibacillus polymyxa SC2]
Sequence
MMNGQWVLPRIVKRVAVMLTAVLLLTLTNGFNWNAPTAEAAGTTPVERYGQLSVKNGKLV
DKNGQPVQLKGISSHGVQWFGDLVNQDTMKWLRDDWGISVFRVALYTEENGYIANPSLKN
KVKEAIEAAQKLGLYVIIDWHILSDGDPNTHKNEAKAFFNEFSTKYGHLPNVIYELANEP
NGNVNWNNQIRPYASEVSQVIRAKDPDNIIIVGTGTWSQDVHDAADHPLLDKNTMYTVHF
YAGTHGQSLRDRIDYALNKGVGIFATEWGTSDASGNGGPFLNESKVWTDFMASRKISWAN
WSLSDKNETSAALLPGADRKGGWPDSQLTASGKFVKQAILEGSSNHGGGSNGGNSGGDGN
NGSNNNGGNNGGDHSGSTPGGNNEGIVLQYRTDDTNAKDNAIRPQFNIKNTGKTAVKLSD
LKIRYYYTDESKQAQQFFVDWAKIGNEKVKATFVTLPNPKSKADKYVEISFTDGAGTIQP
GGETGEIQSRIHAANWSNFDETNDYSYGAAQTVFADWDHGTVYQQGKLVWGIEP
Download sequence
Identical sequences E3E5T1
WP_013372536.1.14980 WP_013372536.1.91857 gi|310643441|ref|YP_003948199.1| gi|507716712|ref|YP_008049321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]