SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644036|ref|YP_003948794.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644036|ref|YP_003948794.1|
Domain Number 1 Region: 446-589
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-21
Family Histidine kinase 0.011
Further Details:      
 
Domain Number 2 Region: 317-367
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000115
Family HAMP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310644036|ref|YP_003948794.1|
Sequence length 596
Comment integral membrane sensor signal transduction histidine kinase [Paenibacillus polymyxa SC2]
Sequence
MYRGVRHLMNNMRMRNKLLFSYVLIVMIPVLVVGGCVTFYLREQALDSAIAQTVNNVEKI
KSQTANLLRVPTDISNGLMFDKRLKEMANRRYPGMVELMNAYHQYKDFNEYTQQYREVAT
IRFYSYNPTLVNNLEFIPVDSNIERQPWFQEALKGTAINWFYIQDKEDTPVNRLSLVRQI
PFPEYNSKGVLMIALSQTELNHMLSKEPFETLIADRNGIVVAATHPQSVGQTLTDLHLGF
DVQRAGKGIYEAKINGTPSNIIVDELLPTSSVSGLTIISVFSTEHIVQGANRVSLIGALC
VLAVLIMALILITIISWLITKRLQRLSYELGQVAAGDFHVVSSVEGRDEIGDLSRRFNYM
VSSIRQLMAQVYETSEHNNKLELAQKDIKLKMMASQINPHFLFNALESIRMKAHLNGEAE
IATTVRLLGRLMRRNLEIGSGKTTVLQELDMVRSYLQIQQFRFGNRLVYEVNLEESAKDM
SIPPLIIQPLVENAVIHGLENKEEPVTVKVDITIEQRELHIKVADDGIGMKEEQLTRLLA
RITGTEEPEGSSIGLRNVHQRLTLMYGERYGLHIESALQVGTTVYFSIPREEASNV
Download sequence
Identical sequences E3EAD5
gi|507717257|ref|YP_008049866.1| WP_013373120.1.14980 WP_013373120.1.91857 gi|310644036|ref|YP_003948794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]