SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506931856|ref|YP_008012294.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506931856|ref|YP_008012294.1|
Domain Number 1 Region: 149-207
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000714
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0093
Further Details:      
 
Weak hits

Sequence:  gi|506931856|ref|YP_008012294.1|
Domain Number - Region: 15-147
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0173
Family Phospholipase D 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506931856|ref|YP_008012294.1|
Sequence length 213
Comment erythropoiesis-stimulating protein [Amycolatopsis orientalis HCCB10007]
Sequence
MSASSAPNPTDGTSLSTVLDLVSTARREVLTTATGGSPWFGGTVTEAARRGAFPRHVRVR
LLCTTPAEHTRGELIEAVRHGLRVKVTDRAIEESLLIDRRLALVPSGGDDAGSLLMVTTP
TLISALADAFDPRWEEATPWELTSARPDEFEQAILRCLVDGMTDEAVANRLGVSARTVRR
YVNVLMARVGARSRFELGFRAAECGWLPAGALD
Download sequence
Identical sequences R4T0I7
gi|506931856|ref|YP_008012294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]