SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506930732|ref|YP_008011170.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506930732|ref|YP_008011170.1|
Domain Number 1 Region: 96-261
Classification Level Classification E-value
Superfamily TPR-like 5.69e-30
Family BTAD-like 0.0002
Further Details:      
 
Domain Number 2 Region: 258-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.23e-17
Family RecA protein-like (ATPase-domain) 0.068
Further Details:      
 
Domain Number 3 Region: 2-94
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000425
Family PhoB-like 0.00092
Further Details:      
 
Domain Number 4 Region: 873-1029
Classification Level Classification E-value
Superfamily TPR-like 0.000000000219
Family Tetratricopeptide repeat (TPR) 0.079
Further Details:      
 
Domain Number 5 Region: 800-910
Classification Level Classification E-value
Superfamily TPR-like 0.00000137
Family Transcription factor MalT domain III 0.061
Further Details:      
 
Weak hits

Sequence:  gi|506930732|ref|YP_008011170.1|
Domain Number - Region: 539-615
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0104
Family MarR-like transcriptional regulators 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|506930732|ref|YP_008011170.1|
Sequence length 1093
Comment ATPase-like protein [Amycolatopsis orientalis HCCB10007]
Sequence
MRFGVLGPLAVWTTGGSPVTVKESKVRALLAVLLINQGRPVSADRLIDDLWGGQLPLNPL
KTLQTRVWQLRKALEDAEPGGRDLVVSQPPGYLLRVDPEMVDTGRFRALISQARATGEPV
AKARLLSEALELWRGPAFADFRDAEFAGPTVQRLEEQRLLAVEERTEARLAWEDPADLAV
ELSELVGRHPLRERLRAVHMRALYRAGRQNDALTSYGTLRHRLAEDLGLDPGPELAALHQ
AILERAPHLGAAPTTPAPRTNLPTALTALVGRADAVTDVRSQVTAARLVTLTGPGGVGKT
RLAVEVATQLAGTFPDGVWLAELAELDHSTRSGRPSSLSALVDLVTTVLGIRADPTTIPL
PATKPATSIEHLAAALRARRLLLVLDNCEHVIEPVAELTDRLLSAAPELRILATSRQPLE
VDGELLWPVAPLEPPAPGAPIEAVRRSGAVQLFVARATAATPEFTLNQDNADAVATVCRA
LDGIPLALELAATRTRALGVRELAARVDDRFPLLTNGKRGAPARQRTLRAMIDWSWELLT
EAERVVLRRLSVHAGGCTIEAAEETCAGDGVPRNAIVDLLARLVDRSLVVMTETTDGPRY
RLLESVAAYCHERLHEAGESTRIRHRHHRYYIELAEHAEPRLRGGHQRHWLRRLDTETAN
LHRALDHAIRHGQAAWALRLANALSWYWFLRGRLGEARRTLNRVLDLEGTAPAAARAIAT
VWRTGITLLIRDNAEADTTTPEHALDTLHKSVDDPAARAFAEWFLVFAQLGFGTTVTTDG
WINRLRSAFHAIGDRWGIAATSTMGAFVLAEGDLPEAARLGRESLALFEELGDRWGQLKA
GQLLAMLAEATGDYEQAALFRRQGLRNAEELGLWTEAAHELSSLGRSALLAGDYATAKQL
HTRAMRLATEQSYQWGIQHAEVGLGLGARRQGRLDVAETHLRNWLDWCRRWKGTPGLTLI
LAELGFIAELRGDTRAALALQLDGYAAARSTGDRRAIALALEGLAGAHSLADRHDHAARL
LGAAAMLRRSAGAPMPPAEHGDIDRITARIRQALGDGAFATAFHHGQETGLDTIVTCDHA
HSRTASGVDCEIS
Download sequence
Identical sequences R4T173
WP_016332562.1.6660 gi|506930732|ref|YP_008011170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]