SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506930779|ref|YP_008011217.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506930779|ref|YP_008011217.1|
Domain Number 1 Region: 94-264
Classification Level Classification E-value
Superfamily TPR-like 1.9e-40
Family BTAD-like 0.00037
Further Details:      
 
Domain Number 2 Region: 255-515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-30
Family Extended AAA-ATPase domain 0.02
Further Details:      
 
Domain Number 3 Region: 798-971
Classification Level Classification E-value
Superfamily TPR-like 5.94e-18
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 4 Region: 2-89
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000068
Family PhoB-like 0.0012
Further Details:      
 
Domain Number 5 Region: 714-824
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000854
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506930779|ref|YP_008011217.1|
Sequence length 983
Comment AfsR-like regulatory protein [Amycolatopsis orientalis HCCB10007]
Sequence
MRFSLLGPVEVAGPSGPIALPGVKPRTLLAALLLGYGRTVPAERLIGVVWGEEPPTTARA
VVQTYVATLRRAFDAAGLPQVIVSDRNGYRADVAEDVLDVRMFERLVERGRQAAQGGDHT
GAADLFRSGLALWRGPALGGIGESFLRAEASRLDELRLTVVEERVDADLAAGQGPRLLAE
LTELVALHPTRERLRGGLMVALYRSGRQAEALDVYERGRKVLADELGIDPGPELRQVHES
ILRSDAALLPAVTSRTPRQLPSPPPDFTGRAPELAELRATLVRPGEMPVAVVSGAGGVGK
STLVHRIAHEIAEHFPGGQLHLELHGSTGSPATAEEVLGRVLRDFDPATTPPGSLDERVA
RYRTVLAGTRTLVVLDDAANEAQVRPLLPGGPGCAVIVTSRNRLPALAGATFCELGVLPA
DAALDLLTRIVGAERASTEPASAAEITELCGQLPLAIRVAGARLVSRRQWSLSRLANRLA
QEQRRLDELVVGDQEVRASINLSYTLLPKAARTALRRLGSLGLAHFPAWVAAAALESDPD
DAEQVLEDLVDVSLLEVDGVDPLGLMRYRLHDLVRLFALERAVEEESAADRAATVERVLG
GWIWLVERINETLPPVVPSIQGISRLGRPVGEEIARRVVARPYEWFRAEEEAMTTAVELA
AALDLVDIAVGLSSALCGTAFGGHNRVLDDSLGSWRRTHDAALTAARRTENALGEATLLA
GLGQLYYEHDDFPRSRAHLSQALSMFRAAGDVRGEAATLAALGAACREQGYLPEAVHFLD
RAGRMWSGLDDPGAMGHVHRLAGTVRLELGEYPGALTALTEARASFAAAGSRRGEGLTLR
SLSLYHRARGEWAEAEECARAALAVFEGTEDRMLAAYSERALAKALLRRGDSVAARRLAE
NALEVCRELGDAFGHACTLRVVGEVHLAEGRLYQAKDCLEDSLRRWTDLRAELFRARTLR
TLAEVHDALGDVRAGERMTAEAC
Download sequence
Identical sequences R4SMN5
gi|506930779|ref|YP_008011217.1| WP_016332609.1.6660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]