SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506931857|ref|YP_008012295.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506931857|ref|YP_008012295.1|
Domain Number 1 Region: 90-256
Classification Level Classification E-value
Superfamily TPR-like 3.41e-35
Family BTAD-like 0.00072
Further Details:      
 
Domain Number 2 Region: 268-525
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.68e-25
Family RecA protein-like (ATPase-domain) 0.052
Further Details:      
 
Domain Number 3 Region: 713-899
Classification Level Classification E-value
Superfamily TPR-like 6.07e-23
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000737
Family PhoB-like 0.0025
Further Details:      
 
Domain Number 5 Region: 934-1041
Classification Level Classification E-value
Superfamily TPR-like 0.000000114
Family Tetratricopeptide repeat (TPR) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|506931857|ref|YP_008012295.1|
Sequence length 1075
Comment SARP family transcriptional regulator [Amycolatopsis orientalis HCCB10007]
Sequence
MEFTILGPLGVRDGNTELELGAPKVRRLLALLLHRAGEVVPVSALVDGLWAGRPPRTAAK
NLQLYVLQLRRALADPDRVVHRRPGYLLVVNPGELDVRRFEDLADQARTAHERRNAVVAG
SLARQALAVWQGPPFGGLADSSTALQVEADRLQERRLVVLEQRIDADLTLGRHVDVVAEL
TELVWEHPLRERFHAQLMLALYRSRRQAEALEVYRRARALLTGELGLEPGAELTDLAQAI
LRTDPALDLSAAGQAVSAGPRQLPAAVPTFTGRTVQLRRIDALVAGGAPVVVVSGTAGVG
KTALALQWAHGALDRFPDGQLYLNLHGYARSATVTAAEALVRLVRSLGVPPDRIPVDPDE
LAALYRSELAGKRILVVLDNAGTADQVRPLLPGRPGSLVVVTGRQELPGLVVLHDAGAVR
LDLLTEEEGLKLLARIVGAQRVKEERRAAATLVRLCAGLPLALRIAAADIGIGRDRPIGA
VVDGLRADRLDRLGIDGDPSTAVRAAFELSYRRLGPVAQGLFRLLGVVQVPDFTARSIAV
LAGQAPGDTSEALAELERAHLVARGADGRYQCHDLLRLYATERARAEDDAAGRDAARLRL
FGWYLATVTAAVTRITPQILRLREGAEFGETDVVFDDDAEALEWLEAERACLMAIVHDAA
AHGPHRIVWLLADALRGFFWLRRHSVDWITVAKAGLAAAVADGEPRGRIAARQSLAQVYR
GLGDYAAAVTHYTRALELATSERWPEAEAAARGNLAGVHWELGALDEAVAELDRAIELNS
RMGWEAGLSANLHNIGTLLRELGKPQEAIRRLAQALSLIERNGNRDGAAHVYTTLGEVYL
DLGRLTDARESLSKGVSLHRENGARYGEATALCSLAALCAETGDFTEAAEHAEAMLELAR
ETGDRRAEANALAALAELGGRTELPMAPEVLAGQAVELAHKIHYTRAEIVSLLALAEVCR
RGGRLDDAVTHAGAAAELAARRDFRLLAARAQTVLATSRLDRGDRKQAAECAERALTLHR
RTGNRVGEGHALAVLGEVTAKRDPGAGQGLLRKAHDILADCGSVERFRVANLLAT
Download sequence
Identical sequences R4T4I0
gi|506931857|ref|YP_008012295.1| WP_016333658.1.6660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]