SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506932630|ref|YP_008013068.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506932630|ref|YP_008013068.1|
Domain Number 1 Region: 96-258
Classification Level Classification E-value
Superfamily TPR-like 2.47e-31
Family BTAD-like 0.00061
Further Details:      
 
Domain Number 2 Region: 257-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-17
Family Extended AAA-ATPase domain 0.064
Further Details:      
 
Domain Number 3 Region: 3-94
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000709
Family PhoB-like 0.0018
Further Details:      
 
Domain Number 4 Region: 817-930
Classification Level Classification E-value
Superfamily TPR-like 0.000000000449
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number 5 Region: 742-850
Classification Level Classification E-value
Superfamily TPR-like 0.0000119
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506932630|ref|YP_008013068.1|
Sequence length 1062
Comment ATPase-like protein [Amycolatopsis orientalis HCCB10007]
Sequence
MRFGVLGPLAAWTTAGEPVAVPEAKVRLLLAALLSREGRAASVSSLTDDLWGEHPPGNPG
NTLQTKVSQLRRALDKAEPGARELVTHQPAGYVLAVEPGDLDVHRFRALTARARDAVDPR
ARAALLADALALWRGPAYAGFEDELFAVAAAQRLEEERLLAEEDRAEARLMLGEHGVLTG
ELAGLVSRNPLRERLRGLLMRALYAAGRHSEALETYAELRARLRDESGLEPGPDLAALHQ
AILTRSPELEPARAAEPVRGNLPEALTELIGRTTAVKEVEALVTDTRLVTLTGPGGVGKT
RLAIEAASKLAMADGTWLVELAGLDVVECPTCPPEDLVAVVVAAVLDLREEATSTGTLTQ
SMAAALRDKEILLVLDNCEQVVEPVAALVERLLAAVPRLRVLATSQEPLGLPGENVWAVP
PLELPEHPDFAAVRESSAVRLFAARAEAAAPGFALDSENAAVVARICRTLDGIPLALELA
ATRVRTLGVHELLARLDDRFGLLSSGRRGGPRRQQTLRAMIDWSWSLLSEPEQIVLRRLA
VHAEGCGLDAAESVCAGGEIAAGDVLDLLSRLVDRSLVVSRPGRAGEPRFRLLESVSAYA
LDHAEQAGELEDLYLRHARFHVELAERGDAGLRGREQRRWLDRLDAEGANTRRALETLLR
QGEHRLAARLVNATTWFWFLRGRLTEARRSLDLVLATEIDTGDEYAQALGWRTGIAVLDG
TGTDAAVEETVRGIADAGVRARMSWFLGYAWSTVGDLCRAEKLTLDALETARDIGDDWSA
AAALSDRASHLISGGDLTGGGRIAAQSAAIFDGLGERWGWLQASFVIGMLASIAGDYDHS
ARVHRESLRRAEELELWPEVTYKLSWLGRTALLTGHFEEAKEFHEQARALAVEHGFKPGE
VYAETGLALGARREGLLDEAERRLLSILDWHRRVESEAGSTLILAELGFIAEQRGDAAAA
KRLQLEGLAIARESEDPRAIALGLEGLAGAEAAAGAHHLAARLLGAAAACRRSVGAPLPK
AERGDVDRITGVVVAALGETAFSAENEAGEATPIDQLVTDSQ
Download sequence
Identical sequences R4SVV1
gi|506932630|ref|YP_008013068.1| WP_016334417.1.6660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]