SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|506933328|ref|YP_008013766.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506933328|ref|YP_008013766.1|
Domain Number 1 Region: 115-253
Classification Level Classification E-value
Superfamily TPR-like 1.4e-21
Family BTAD-like 0.0013
Further Details:      
 
Domain Number 2 Region: 252-516
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-19
Family Nitrogenase iron protein-like 0.077
Further Details:      
 
Domain Number 3 Region: 729-885
Classification Level Classification E-value
Superfamily TPR-like 3.6e-18
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number 4 Region: 2-92
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000224
Family PhoB-like 0.00079
Further Details:      
 
Domain Number 5 Region: 857-965
Classification Level Classification E-value
Superfamily TPR-like 0.0000000806
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  gi|506933328|ref|YP_008013766.1|
Domain Number - Region: 647-741
Classification Level Classification E-value
Superfamily TPR-like 0.000228
Family Tetratricopeptide repeat (TPR) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|506933328|ref|YP_008013766.1|
Sequence length 981
Comment XRE family transcriptional regulator [Amycolatopsis orientalis HCCB10007]
Sequence
MDFRVLGPVRLQVRGRAVAIGEPRRQAVLAVLLFEAGRTVGVDLLIDRVWGESPPERVRR
SLQAHITRIRRALEQADPAGARVTRDPGGYRLVARPEQVDVFRFRRLLREHPTDVTRLSA
ALELWEGEPLAGLRGDWAERTRRTLYQERTAAIVAWADAKIREGDAAATLTRLTELTDEQ
PLQEPAAAALMRALYAVGRGADALTHYERILRALREELGADPGPELAAVHEAVLRHDLPT
VAAAPPPVPAQLPADVAAFTGRAGELAELDRLADGAGEEPVLVCLTGTAGAGKTATAVHW
GHRMRDRFPDGQLYLDLCGYAPGEPMSSADALAALLSALLPEGTRMPSGEAERAARFRTE
VAGRRMLVLLDNAATLEQIRPLLPGTHSCAVVVTSRDSLAGLVALHGAHRVDVDRLSVAD
AADLLRRLIGTRVTAEPEAAAELAERCVRLPLTLRLVAELAVSRPSTPLSRLVGELRAAQ
QTLKLLSSGGDQRAAVRAVFSWSLRQLSEDTVRAFALLGRHPAPVFDSYALAALTGSSYD
QARAWLDALVRAHLVHPVGADRHGMHDLLKAYAAEIECDEPAALDRIYGYYLATVAAAMD
RLYPAEANRRPTVASPKCVIPALDDADSARDWLDAELPTVQALAAAGRPEHAVTLSALLF
RYLDGHHETAALAVHGHAIKAARAIGDRRAEAEVLVAVGGLHMQAGRAESAAAAMWAAYD
LFDEAGNPLGQARALGNVGMIEESAGYYRQAVGYYTRALALFRRLGDLTGQAHQLTRLGT
VEARIDRREQGYEHLRQAMALHREAGHRFGEAWVKIGLGELAANEGGPADSCRLHSEAAA
LFGKLGHRGSEAWAIDGLGRAEALDGRPVDAAAHHRQALDLFRRHGGRDGESWALNGLGE
ACLACGYPDTACANHAEALAVATRYGCHEQIARAHRGLARAASDPETVRDHYERAIAGYA
ELGLPAAEGTKTELAELSSSC
Download sequence
Identical sequences R4TA39
WP_016335111.1.6660 gi|506933328|ref|YP_008013766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]